BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0766 (484 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.4 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 7.9 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 431 VRRVFGY*RPPVFLGGILEVDHDQPVVGSIL 339 + ++G VF+G +L++ D P+ S L Sbjct: 949 ISAIYGLIMMAVFVGVMLQISQDGPLAPSSL 979 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 431 VRRVFGY*RPPVFLGGILEVDHDQPVVGSIL 339 + ++G VF+G +L++ D P+ S L Sbjct: 949 ISAIYGLIMMAVFVGVMLQISQDGPLAPSSL 979 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/33 (27%), Positives = 14/33 (42%) Frame = +3 Query: 381 NPAKENWRTLVPEHPTDVLDWAAAVDQDKLVIH 479 NP + + + H +LDW DK + H Sbjct: 202 NPHAKLYDYDLSSHVITILDWTKEDGTDKFMSH 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,690 Number of Sequences: 336 Number of extensions: 1877 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -