BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0762 (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 26 0.84 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 25 2.6 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 26.2 bits (55), Expect = 0.84 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +1 Query: 286 WLLEPIDIYNVNAPPTLRYKF*GLKYSYNGCPTLQTETHYCFTAETGGV 432 ++ +P D YNVN T + L+ + C L E+ C+ G + Sbjct: 98 FVTDPADAYNVNRTETCLQELPALELNAEKCCGLAFESFLCYYYNYGNL 146 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 24.6 bits (51), Expect = 2.6 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 256 GRAHSPPGVKWLLEPIDIYNVNAPPTLRYKF*GLKYSYNGCP-TLQTETH 402 G H P + P+++Y V R++F + + + CP LQ E H Sbjct: 257 GTYHDPKKNETTQTPLEVYTVRRGARFRFRF--INAASHVCPLQLQIEDH 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,661 Number of Sequences: 2352 Number of extensions: 11960 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -