BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0762 (620 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea... 27 7.6 At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea... 27 7.6 At2g14720.2 68415.m01657 vacuolar sorting receptor, putative ide... 27 7.6 At2g14720.1 68415.m01656 vacuolar sorting receptor, putative ide... 27 7.6 >At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 51 YCSHSFRLSTPVKTYIVNVNNTIVPVHEIDF 143 YC H+F LS K+ +N P E DF Sbjct: 240 YCPHAFTLSRQCKSQCINKGRYCAPDPEQDF 270 >At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 51 YCSHSFRLSTPVKTYIVNVNNTIVPVHEIDF 143 YC H+F LS K+ +N P E DF Sbjct: 240 YCPHAFTLSRQCKSQCINKGRYCAPDPEQDF 270 >At2g14720.2 68415.m01657 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 51 YCSHSFRLSTPVKTYIVNVNNTIVPVHEIDF 143 YC H+F LS K+ +N P E DF Sbjct: 240 YCPHAFTLSRQCKSQCINKGRYCAPDPEQDF 270 >At2g14720.1 68415.m01656 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 51 YCSHSFRLSTPVKTYIVNVNNTIVPVHEIDF 143 YC H+F LS K+ +N P E DF Sbjct: 240 YCPHAFTLSRQCKSQCINKGRYCAPDPEQDF 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,020,039 Number of Sequences: 28952 Number of extensions: 226134 Number of successful extensions: 433 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -