BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0758 (591 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 230 GGALSVTALTRGTPSLSVI 174 GG +SVT L R P L V+ Sbjct: 233 GGYISVTGLKRVNPKLKVL 251 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 172 LITDRDGVPLVRAVTERAPP 231 LI D +PL AV +R PP Sbjct: 73 LIADSRRLPLRDAVEKRPPP 92 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 3.4 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 271 ATDQASKLGLGRNKTIISMYSSYQVVQMSKLPLVITF-IGSDNCNTGHILSLESQI 435 A+DQA+ + +N S S +V Q+ P ++ F G D+ N G +S++ + Sbjct: 573 ASDQATYDCVAKNSQGYSARGSLEV-QVMVPPQILPFDFGEDSINEGDGVSVQCTV 627 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,248 Number of Sequences: 336 Number of extensions: 3375 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -