BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0757 (493 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68009-2|CAA92004.2| 891|Caenorhabditis elegans Hypothetical pr... 28 4.2 Z81485-6|CAB03979.1| 784|Caenorhabditis elegans Hypothetical pr... 27 5.6 >Z68009-2|CAA92004.2| 891|Caenorhabditis elegans Hypothetical protein R09A8.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 245 FWLLSRHGSHNPEANETAELQQLVDLKNNI 334 FW +H S +ANE A +D+++N+ Sbjct: 759 FWQKEKHESSRDDANENASFVHSLDVESNV 788 >Z81485-6|CAB03979.1| 784|Caenorhabditis elegans Hypothetical protein C49F5.6 protein. Length = 784 Score = 27.5 bits (58), Expect = 5.6 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = +2 Query: 188 NRGIPNAKAHEVPGCQPVAFWLLSRHGSHNPEANETAELQQLVDLKNNIVTNYKNGNFRN 367 ++ +PN + E P V + +G + + A + LV K+N NY + + Sbjct: 86 SKSVPNILSGEYPNSVCVVANSIDENGDAGVDVTDCASTKPLVLGKDNYQDNYWDS--QE 143 Query: 368 TNHR 379 TNHR Sbjct: 144 TNHR 147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,926,096 Number of Sequences: 27780 Number of extensions: 208894 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 924715866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -