BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0753 (549 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_04_0014 + 7578921-7579649 29 2.4 04_03_0735 + 19141038-19143227 28 4.3 11_06_0284 + 21909758-21913645 27 7.5 01_01_0801 - 6241710-6241869,6242522-6242689,6243202-6243269,624... 27 7.5 >10_04_0014 + 7578921-7579649 Length = 242 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = -3 Query: 496 CKSTSHSHLYSHALTGIKNRMIIITQVQMTATLHMNKTRLNNTQ 365 C+ ++ +H H+L+G+ NR V++ +H+N L+ Q Sbjct: 23 CRRSTATHGCCHSLSGVGNRQQFARSVEVIQKIHINVPLLDAMQ 66 >04_03_0735 + 19141038-19143227 Length = 729 Score = 28.3 bits (60), Expect = 4.3 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 452 RHKKSYDYNYSSTNDRY 402 +H++SY YNYS+T + Y Sbjct: 303 KHEESYSYNYSATGNSY 319 >11_06_0284 + 21909758-21913645 Length = 1295 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 147 KYHMKIQDIYNSLDSF*NTKFQFDNNKISFNYVSC 43 K H +Q + SLD+ T F + N + Y SC Sbjct: 792 KLHSTLQASHKSLDAIAKTMFMYSYNDLPKEYKSC 826 >01_01_0801 - 6241710-6241869,6242522-6242689,6243202-6243269, 6243372-6243593,6243676-6243774 Length = 238 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 336 TPLGRLILFDCVLFNL 383 TPLG ILFDCVL L Sbjct: 192 TPLGNKILFDCVLETL 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,223,908 Number of Sequences: 37544 Number of extensions: 208863 Number of successful extensions: 337 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -