BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0752 (308 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 31 0.007 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 30 0.023 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 29 0.052 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 27 0.12 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 0.49 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 2.0 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 2.0 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 2.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 6.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 21 7.9 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 21 7.9 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 31.5 bits (68), Expect = 0.007 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +2 Query: 107 KNGNDNFT--ARMFTEVVKNNPGKSVVLSAFSVLPPLAQLALASDGETHEELLKAIG 271 K +D+ T A + N K+ + S S+ L+ L L S G+T +ELL +G Sbjct: 25 KKVSDSVTNLAAKIANALSNQKSKTEIFSPVSIAGALSLLLLGSGGQTQQELLAVMG 81 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 29.9 bits (64), Expect = 0.023 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +2 Query: 116 NDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQL--ALASDGETHEELLKAIGFPDDDA 289 ND+F + EV+ PG +V+ S SV LA L AS ET EL +A+ + A Sbjct: 45 NDDFDWSVIKEVLHKAPGNAVI-SPLSVKALLALLYEGSASRSETERELQQALSGGNSQA 103 Query: 290 I 292 + Sbjct: 104 V 104 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 28.7 bits (61), Expect = 0.052 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = +2 Query: 41 IICLFTIAIAAMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQL 220 I+CL + + A ++ + N MF + + N +VVLS FSV L + Sbjct: 8 ILCLAALLVFDATAQQDVHGPFQGQRQNEFDLMFVKEIFKNHNSNVVLSPFSVKILLTLI 67 Query: 221 ALASD 235 ASD Sbjct: 68 YEASD 72 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 27.5 bits (58), Expect = 0.12 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +2 Query: 38 TIICLFT-IAIAAMAAVTN---LSNVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSV 199 TI C+F + + N L L GN A F +V +NN G++ AFS+ Sbjct: 62 TIQCMFAKVGFTLESGAANRDVLIAKLSKGNPTAKAEAFADVCENNEGETACDKAFSL 119 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 0.49 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 106 EHIREICDGCHCRDGDSKQTNDC 38 +H R +C C CR+G + DC Sbjct: 607 DHGRCVCGQCECREGWTGPACDC 629 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/47 (23%), Positives = 18/47 (38%) Frame = +3 Query: 9 FERRRPQT*RQSFVCLLSPSRQWQPSQISLMCSKMETITSQPECLPK 149 F +R+ R + P+ W P L ET+ + LP+ Sbjct: 590 FLKRKEPDWRDRLLHCFKPTHDWGPEDPELNAKYHETVYRHEQSLPR 636 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/47 (23%), Positives = 18/47 (38%) Frame = +3 Query: 9 FERRRPQT*RQSFVCLLSPSRQWQPSQISLMCSKMETITSQPECLPK 149 F +R+ R + P+ W P L ET+ + LP+ Sbjct: 590 FLKRKEPDWRDRLLHCFKPTHDWGPEDPELNAKYHETVYRHEQSLPR 636 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 22 GHKHEDNHLFVYYRHRGN 75 GH DN +++YY GN Sbjct: 163 GHDFIDNIMYIYYGTNGN 180 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 294 RIASSSGKPIAFKSSSWVSPSEAK 223 R S G+ ++ +SSS SPS+ K Sbjct: 1575 RERSKQGRKVSDQSSSQTSPSKRK 1598 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 4 EDSRDAGHKHEDNHLFVYYRHRGNG 78 ED+ ++ H H H ++ H G G Sbjct: 1306 EDTLNSSHLHHHLHHGHHHHHGGEG 1330 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 22 GHKHEDNHLFVYYRHRGNGSRH 87 G KH+DN F Y + ++H Sbjct: 27 GRKHKDNVKFYYQKWMEEQAQH 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 306,589 Number of Sequences: 2352 Number of extensions: 5961 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 19884282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -