BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0752 (308 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 30 0.28 At5g37490.1 68418.m04515 U-box domain-containing protein similar... 29 0.48 At1g33390.1 68414.m04133 helicase domain-containing protein simi... 29 0.48 At5g08510.1 68418.m01009 pentatricopeptide (PPR) repeat-containi... 29 0.84 At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containi... 29 0.84 At1g60770.1 68414.m06841 pentatricopeptide (PPR) repeat-containi... 27 2.6 At3g09060.1 68416.m01065 pentatricopeptide (PPR) repeat-containi... 27 3.4 At2g20210.1 68415.m02363 leucine-rich repeat family protein cont... 27 3.4 At2g25800.1 68415.m03096 expressed protein 26 5.9 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 26 5.9 At1g78920.1 68414.m09201 vacuolar-type H+-translocating inorgani... 26 5.9 At1g62700.1 68414.m07077 no apical meristem (NAM) family protein... 26 5.9 At3g46200.1 68416.m05001 MutT/nudix family protein similar to he... 25 7.8 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 25 7.8 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 30.3 bits (65), Expect = 0.28 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 187 REDNAFPWIIFHYFGKHSGCEVIVSIFEHIREICDG 80 R D +++F KHS CE+ VS E ++ G Sbjct: 2 RSDTVLDYVVFELSPKHSKCELFVSSNEQTEKLASG 37 >At5g37490.1 68418.m04515 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 435 Score = 29.5 bits (63), Expect = 0.48 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 211 ERRQHRKCREDNAFPWIIFHYFGKHSGCEVIVSIFEHI 98 E ++RKC +N+ W++ F K SG E + + I Sbjct: 153 ESEKNRKCVNENSVGWVLCDCFDKFSGDEKLTFMLNEI 190 >At1g33390.1 68414.m04133 helicase domain-containing protein similar to kurz protein [Drosophila melanogaster] GI:5869803; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1237 Score = 29.5 bits (63), Expect = 0.48 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 146 EVVKN--NPGKSVVLSAFSVLPPLAQLALASDGETHEELL 259 E VKN +PGK VL +++L P AQL + + E E L+ Sbjct: 636 EQVKNKFSPGKLRVLPLYAMLSPAAQLRVFEEVEKEERLV 675 >At5g08510.1 68418.m01009 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 511 Score = 28.7 bits (61), Expect = 0.84 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +2 Query: 86 TNLSNVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQLALASDGETHEELLKA 265 T +S +NGN + +MF + K+ K ++ SVLP A L G E + Sbjct: 184 TVISGFSQNGNYSEALKMFLCMEKDKSVKPNHITVVSVLPACANLGELEIGRRLEGYARE 243 Query: 266 IGFPDD 283 GF D+ Sbjct: 244 NGFFDN 249 >At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 613 Score = 28.7 bits (61), Expect = 0.84 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 184 EDNAFPWIIFHYFGKHSGCEVIVSIFEHIRE 92 +D F ++ +GKH CE + IFE +RE Sbjct: 434 KDPVFWNVMISGYGKHGECESAIEIFELLRE 464 >At1g60770.1 68414.m06841 pentatricopeptide (PPR) repeat-containing protein low similarity to DNA-binding protein [Triticum aestivum] GI:6958202; contains Pfam profile PF01535: PPR repeat Length = 491 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 89 NLSNVLKNGNDNFTARMFTEVVK 157 NL +LKNG DN A +F +++ Sbjct: 431 NLLEILKNGTDNIGAEIFEPLIR 453 >At3g09060.1 68416.m01065 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 687 Score = 26.6 bits (56), Expect = 3.4 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -2 Query: 208 RRQHRKCREDNAFPWIIFHYFGKHSGCEVIVSIFEHIREICDGC 77 R Q KC ED A + +GK+S + + +F+ +REI GC Sbjct: 70 RSQECKCDEDVALS--VIKTYGKNSMPDQALDVFKRMREIF-GC 110 >At2g20210.1 68415.m02363 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 604 Score = 26.6 bits (56), Expect = 3.4 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +2 Query: 98 NVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQLALASDGETHEELLKAIGFP 277 N+ KN TAR ++++ P + ++++++PP A L L T + LK + Sbjct: 503 NISKNRGGLETARFLSKLIPLAPKLISIDASYNLMPPEALLMLCDSLRTAKGDLKRLDMT 562 Query: 278 DDDAI 292 + I Sbjct: 563 GNSCI 567 >At2g25800.1 68415.m03096 expressed protein Length = 996 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 288 ASSSGKPIAFKSSSWVSPSEAKAN*ARGGSTENAERTT 175 AS K + +SSS +SP K++ + GS ++R T Sbjct: 106 ASKMKKALGLRSSSSLSPGSNKSSGSASGSNGKSKRPT 143 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 1 HEDSRDAGHKHEDNHLFVYYRHRGNGSRHKS 93 H D D H H+ NH ++ H G+ H S Sbjct: 311 HHD-HDHDHHHDHNHDHDHHHHDGHDHHHHS 340 >At1g78920.1 68414.m09201 vacuolar-type H+-translocating inorganic pyrophosphatase (AVPL1) identical to vacuolar-type H+-translocating inorganic pyrophosphatase GI:6901676 from [Arabidopsis thaliana] Length = 802 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 126 KLSFPFLSTLERFVTAAIAAMAIVNKQMIVFMFVACVSRILV 1 KL+ LS + F AI M +IVF+F C+ L+ Sbjct: 40 KLNVRVLSIILLFCFGAIFYMGASTSPIIVFVFTVCIISFLL 81 >At1g62700.1 68414.m07077 no apical meristem (NAM) family protein similar to NAC2 (GI:6456751) [Arabidopsis thaliana]; contains Pfam PF02365 : No apical meristem (NAM) protein Length = 394 Score = 25.8 bits (54), Expect = 5.9 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 3 RGFERRRPQT*RQSFVCLLSPSRQWQPSQISLMCSKMETITSQP 134 R F+++ T R+ SPS+ W Q+S M S E I+S P Sbjct: 152 RVFKKKLAATVRKMGDYHSSPSQHWYDDQLSFMAS--EIISSSP 193 >At3g46200.1 68416.m05001 MutT/nudix family protein similar to head organizer protein P17F11 GI:17976973 from [Xenopus laevis]; contains a NUDIX hydrolase domain IPR000086 Length = 311 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 82 GCHCRDGDSKQTNDCLHVCGLRL 14 G +C D D TN+ HVC LRL Sbjct: 75 GGYCLDDDDGSTNEVPHVC-LRL 96 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 246 WVSPSEAKAN*ARGGSTENAERTTLFPGLFF 154 WVS S+A+ R G T + E L P FF Sbjct: 367 WVSRSQAEQRRGRTGRTCDGEVYRLVPSAFF 397 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,470,208 Number of Sequences: 28952 Number of extensions: 122062 Number of successful extensions: 448 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 321405440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -