BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0750 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.02 |apl2||AP-1 adaptor complex subunit Apl2 |Schizosacch... 29 0.36 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 29 0.36 SPAC5D6.13 ||SPAPJ735.02c|Golgi phosphoprotein 3 family|Schizosa... 27 2.5 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 27 2.5 SPCC1235.09 |||histone deacetylase complex subunit|Schizosacchar... 26 4.4 SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protei... 25 5.9 SPBC1718.02 |hop1||linear element associated protein Hop1|Schizo... 25 7.7 SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce... 25 7.7 >SPBC947.02 |apl2||AP-1 adaptor complex subunit Apl2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 29.5 bits (63), Expect = 0.36 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +2 Query: 29 VKCLGDIAFVLIKTIADMKCLTIAALLFVAGLS-IAEKYTDKYDNIDVDEILENRKLLVP 205 +KCLGD+A + I D C++I ++ +S + ++ T + + + + + LL+P Sbjct: 376 IKCLGDVALKVPSVIND--CISIFLEIYELNISYMVQEVTVVMETV-LRKYPQKIDLLLP 432 Query: 206 YIKCVLDE 229 Y+ V++E Sbjct: 433 YLSRVIEE 440 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 29.5 bits (63), Expect = 0.36 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +2 Query: 206 YIKCVLDEGRCTPDGKELKAHIK-DGMQTACAKCTDKQKVSARKIVKHIK--QHEADYWE 376 +I CVL +G + K +G Q C C D K +++KH+K + E+ Y + Sbjct: 1336 HISCVLTQGAYIDLISCITKFAKLNGNQKFCLSCVDMLKNLEHELIKHLKHMKKESVYSK 1395 Query: 377 QMKAKY 394 +++ +Y Sbjct: 1396 KLEEEY 1401 >SPAC5D6.13 ||SPAPJ735.02c|Golgi phosphoprotein 3 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 26.6 bits (56), Expect = 2.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 296 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKD 406 A +D+++ R V H K H Y + K +DPKD Sbjct: 12 AASSDEERPEMRS-VSHSKSHLEGYDDDHKIAFDPKD 47 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 26.6 bits (56), Expect = 2.5 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = -2 Query: 162 MLSYLSVYFSAIDKPATNKSAAIVRHFMSAM 70 +++ LSVY+S + +K +V+HFM+++ Sbjct: 540 LMNCLSVYYSKYFEGKDSKKFTLVKHFMNSL 570 >SPCC1235.09 |||histone deacetylase complex subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 25.8 bits (54), Expect = 4.4 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 563 QQQLN*IWFEFTDQKPFMISYKKKQLFCC 477 ++Q+N + + F D K +I +KK++ CC Sbjct: 529 EEQVNFLRWSF-DDKDLLIGKQKKEIICC 556 >SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 945 Score = 25.4 bits (53), Expect = 5.9 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 38 LGDIAFVLIKTIADMKCLTIAALLFVAGLSIAEKYTDKYDNID-VDEILENRKLL 199 L + V IK + + F+ ++I EKY + YD+++ VDE ++ ++ Sbjct: 710 LNTLGPVTIKLACGTEFSFMKPACFLKNVAIGEKYVEPYDHMEIVDETTGDKAVI 764 >SPBC1718.02 |hop1||linear element associated protein Hop1|Schizosaccharomyces pombe|chr 2|||Manual Length = 528 Score = 25.0 bits (52), Expect = 7.7 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 542 WFEFTDQKPFMISYKKKQLF 483 W FT++ P M+SY +++ F Sbjct: 451 WIYFTNKSPEMVSYLREKYF 470 >SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces pombe|chr 3|||Manual Length = 1008 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 318 RCQPERSLNTLSSTKLITGSR*RPNMIPKMNSK 416 + PE ++S T+ T + P+ +PKMN K Sbjct: 432 KVNPEPHSESISDTRPSTPRKVPPSTVPKMNPK 464 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,359,616 Number of Sequences: 5004 Number of extensions: 46944 Number of successful extensions: 120 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -