BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0749 (597 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0201 - 19225597-19225890,19227832-19228030,19228133-192283... 30 1.6 05_01_0230 - 1725118-1725357,1725474-1726385 28 6.5 >01_05_0201 - 19225597-19225890,19227832-19228030,19228133-19228321, 19228475-19228785,19228899-19229030 Length = 374 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 264 LIQNVMITRSFKNRLSSIQQSLVQNKFDNNNFNIHIAIIEYFK 392 L Q+ RSF + +S I+ SL Q +N N+HI + F+ Sbjct: 136 LPQSNTCLRSFPSNISEIKSSLRQKYASHNKINVHIESADSFE 178 >05_01_0230 - 1725118-1725357,1725474-1726385 Length = 383 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 351 NNFNIHIAIIEYFKTRC 401 NNF H IIEYFK C Sbjct: 297 NNFGSHETIIEYFKNLC 313 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,841,637 Number of Sequences: 37544 Number of extensions: 162917 Number of successful extensions: 234 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 234 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -