Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0749
         (597 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL033514-24|CAA22108.1| 2121|Caenorhabditis elegans Hypothetical...    28   4.4  

>AL033514-24|CAA22108.1| 2121|Caenorhabditis elegans Hypothetical
            protein Y75B8A.24 protein.
          Length = 2121

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 15/62 (24%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = +1

Query: 415  SIC-SSYKRIRISFQILIQIKALMLRHTQACYRNKYMN-I*QQIVIKLQQRE*INFMYAI 588
            S+C  +Y  +R   +  + + +LML     C+R K +N +  +   ++ +++   +MY++
Sbjct: 2037 SLCVHAYLAVRPYHKSFVSLVSLMLDTHLPCFRGKTINQLRARFAPEMNEKDAAKYMYSV 2096

Query: 589  IT 594
            IT
Sbjct: 2097 IT 2098


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,860,788
Number of Sequences: 27780
Number of extensions: 187937
Number of successful extensions: 393
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 392
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 393
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1268802960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)