Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0746
         (607 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    21   7.1  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    21   7.1  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   7.1  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    21   7.1  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   9.4  

>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 275 PQPCRIHSR 301
           P+PCR H+R
Sbjct: 476 PEPCRCHAR 484


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 12/36 (33%), Positives = 15/36 (41%)
 Frame = -1

Query: 127 EFPL*NNTAVLFAGLMSMRHFRNHCQRANAALWSLL 20
           E P    TAV     +    +  H  R   ALWSL+
Sbjct: 69  ELPARGLTAVFLGLNLGFLAWAKHNPRGKDALWSLV 104


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 14/50 (28%), Positives = 18/50 (36%)
 Frame = +2

Query: 161 YHSPDHPLRPTYTLGQEG*VPGSHPGCIHDIPPTHKNSPQPCRIHSRQTL 310
           + SP  P R +     +G  PG  PG      P+         IH  Q L
Sbjct: 28  HQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNPSQMMISPASGIHQMQQL 77


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 275 PQPCRIHSR 301
           P+PCR H+R
Sbjct: 476 PEPCRCHAR 484


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -2

Query: 273 LFLCVGGMSWM 241
           +F+C  GM+WM
Sbjct: 805 VFVCHNGMNWM 815


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,875
Number of Sequences: 438
Number of extensions: 3695
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17848938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)