BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0742 (563 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 1.8 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.4 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 3.2 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 21 9.6 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 424 DSPESL*MKNTKSPN 468 DSP S+ M NT +PN Sbjct: 111 DSPSSMHMANTAAPN 125 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 424 DSPESL*MKNTKSPN 468 DSP S+ M NT +PN Sbjct: 113 DSPSSMHMANTAAPN 127 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 95 RCCTTARPSIRSQSSS*GLLP 157 RCC + P +RS + GL+P Sbjct: 975 RCCGGSFPLLRSLNRGLGLIP 995 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +2 Query: 2 CRNSARGTSRRGSRCEGCTYCSRKSMGRSCCRCC 103 C + A G CEGC R+S+ ++ C Sbjct: 191 CGDRASGYHYNALTCEGCKGFFRRSITKNAVYQC 224 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 485 GLLLQFHLPSLQYRP 529 G +LQ H+ L Y P Sbjct: 84 GTILQLHIYDLHYNP 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,854 Number of Sequences: 336 Number of extensions: 2823 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -