BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0741 (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0370 - 43119049-43120278,43121376-43121420,43121421-431216... 30 1.3 >01_07_0370 - 43119049-43120278,43121376-43121420,43121421-43121662, 43121908-43122686,43123123-43123463,43123565-43123785, 43123866-43124176,43124257-43124516,43124836-43124918, 43124940-43125036,43125132-43125305,43126215-43126592 Length = 1386 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 245 WRPYIVYTLSIFVINKY*IVVLNLLDEIH*YC 340 + P + YT+S+ V+ Y I V ++ DE++ YC Sbjct: 812 FNPLLAYTISLIVVAYYRIGVRDVHDEVNKYC 843 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,084,008 Number of Sequences: 37544 Number of extensions: 165404 Number of successful extensions: 277 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 277 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -