BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0741 (519 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18540.1 68417.m02747 expressed protein ; expression support... 29 2.5 >At4g18540.1 68417.m02747 expressed protein ; expression supported by MPSS Length = 520 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 116 KKNTLRLKIMHTKNVFFIFYKHLFIIVLLMETIILTI 226 KK RL I+ F YKHLF++ L + + L + Sbjct: 136 KKRPSRLSIILLDQGLFTVYKHLFVLSLSLNVLALVL 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,879,798 Number of Sequences: 28952 Number of extensions: 155994 Number of successful extensions: 292 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -