BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0740 (629 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060751-1|AAL28299.1| 242|Drosophila melanogaster GH20208p pro... 31 1.3 AE014134-1569|AAF52715.1| 242|Drosophila melanogaster CG9483-PA... 31 1.3 >AY060751-1|AAL28299.1| 242|Drosophila melanogaster GH20208p protein. Length = 242 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -2 Query: 424 SYFLEYIQ*GIPARYILSDIYKIFEYLQIVFFLNILFVN 308 +YF +I +P +LS + I + I+FF+N+LF+N Sbjct: 137 AYFPMFI---VPGDLLLSCLVAIANIMMIIFFINVLFIN 172 >AE014134-1569|AAF52715.1| 242|Drosophila melanogaster CG9483-PA protein. Length = 242 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -2 Query: 424 SYFLEYIQ*GIPARYILSDIYKIFEYLQIVFFLNILFVN 308 +YF +I +P +LS + I + I+FF+N+LF+N Sbjct: 137 AYFPMFI---VPGDLLLSCLVAIANIMMIIFFINVLFIN 172 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,881,569 Number of Sequences: 53049 Number of extensions: 358442 Number of successful extensions: 535 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2621070450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -