BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0739 (613 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G4.06c |adf1|cof1|cofilin|Schizosaccharomyces pombe|chr 1|... 40 3e-04 SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 25 6.5 SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual 25 8.6 SPBP26C9.03c |||iron ion transporter |Schizosaccharomyces pombe|... 25 8.6 >SPAC20G4.06c |adf1|cof1|cofilin|Schizosaccharomyces pombe|chr 1|||Manual Length = 137 Score = 39.9 bits (89), Expect = 3e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 446 SGVTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAEYEQFLEDL 607 SGV VS C ++E+K K RYVVF + D K V + +++ FL DL Sbjct: 4 SGVKVSPECLEAFQELKLGKSLRYVVFKMNDTKTEIVVEKKSTDKDFDTFLGDL 57 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 25.4 bits (53), Expect = 6.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 379 CRCRGVGEVSGVIFT*ITSKNGV 447 CRC G+ ++SG I + SKNG+ Sbjct: 330 CRCAGIKDISGEI---LGSKNGM 349 >SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 366 Score = 25.0 bits (52), Expect = 8.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 455 TVSDACKTTYEEIKKDKKHRYV 520 TV D C + IK KH YV Sbjct: 316 TVEDFCNNIHSSIKSQFKHAYV 337 >SPBP26C9.03c |||iron ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 452 VTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDV 556 VT D KT + +K KH+ V YIR K +D+ Sbjct: 113 VTNDDGTKTKVDSDEKKHKHKNVRDYIR-FKHVDI 146 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,227,180 Number of Sequences: 5004 Number of extensions: 41358 Number of successful extensions: 100 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -