BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0739 (613 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59890.1 68418.m07510 actin-depolymerizing factor 4 (ADF4) id... 49 2e-06 At2g31200.1 68415.m03810 actin-depolymerizing factor 6 (ADF6) id... 49 2e-06 At3g46010.1 68416.m04978 actin-depolymerizing factor 1 (ADF1) id... 48 5e-06 At5g59880.2 68418.m07509 actin-depolymerizing factor 3 (ADF3) id... 46 3e-05 At5g59880.1 68418.m07508 actin-depolymerizing factor 3 (ADF3) id... 46 3e-05 At3g46000.1 68416.m04977 actin-depolymerizing factor, putative (... 44 8e-05 At5g59890.2 68418.m07511 actin-depolymerizing factor 4 (ADF4) id... 44 1e-04 At5g52360.1 68418.m06497 actin-depolymerizing factor, putative s... 44 1e-04 At1g01750.1 68414.m00094 actin-depolymerizing factor, putative s... 44 1e-04 At4g00680.1 68417.m00093 actin-depolymerizing factor, putative s... 43 1e-04 At2g16700.1 68415.m01916 actin-depolymerizing factor 5 (ADF5) id... 41 6e-04 At4g25590.1 68417.m03687 actin-depolymerizing factor, putative s... 39 0.002 At4g34970.1 68417.m04957 actin-depolymerizing factor, putative s... 37 0.009 At3g45990.1 68416.m04976 actin-depolymerizing factor, putative s... 37 0.012 At4g35250.1 68417.m05010 vestitone reductase-related low similar... 27 7.4 At2g33060.1 68415.m04054 leucine-rich repeat family protein cont... 27 9.8 >At5g59890.1 68418.m07510 actin-depolymerizing factor 4 (ADF4) identical to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana} Length = 139 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRD-EKQIDVETVGERNAEYEQFLEDL 607 ASG+ V D CK + E+K + HR++V+ I + +KQ+ VE VGE YE F L Sbjct: 5 ASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL 60 >At2g31200.1 68415.m03810 actin-depolymerizing factor 6 (ADF6) identical to SP|Q9ZSK2 Actin-depolymerizing factor 6 (ADF-6) (AtADF6) {Arabidopsis thaliana} Length = 146 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +2 Query: 446 SGVTVSDACKTTYEEIKKDKKHRYVVFYI-RDEKQIDVETVGERNAEYEQFLEDL 607 SG+ V+D KTT+ E+++ K HRYVVF I +K++ VE G Y+ FL L Sbjct: 13 SGMGVADESKTTFLELQRKKTHRYVVFKIDESKKEVVVEKTGNPTESYDDFLASL 67 >At3g46010.1 68416.m04978 actin-depolymerizing factor 1 (ADF1) identical to SP|Q39250 Actin-depolymerizing factor 1 (ADF-1) (AtADF1) {Arabidopsis thaliana} Length = 139 Score = 48.0 bits (109), Expect = 5e-06 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRD-EKQIDVETVGERNAEYEQF 595 ASG+ V D CK + E+K + HR++V+ I + +KQ+ VE VG+ YE+F Sbjct: 5 ASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEF 56 >At5g59880.2 68418.m07509 actin-depolymerizing factor 3 (ADF3) identical to SP|Q9ZSK4 Actin-depolymerizing factor 3 (ADF 3) (AtADF3) {Arabidopsis thaliana} Length = 124 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRD-EKQIDVETVGERNAEYEQFLEDL 607 ASG+ V D CK + E+K + HR++++ I + +KQ+ VE +GE +E L Sbjct: 5 ASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKIGEPGQTHEDLAASL 60 >At5g59880.1 68418.m07508 actin-depolymerizing factor 3 (ADF3) identical to SP|Q9ZSK4 Actin-depolymerizing factor 3 (ADF 3) (AtADF3) {Arabidopsis thaliana} Length = 139 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRD-EKQIDVETVGERNAEYEQFLEDL 607 ASG+ V D CK + E+K + HR++++ I + +KQ+ VE +GE +E L Sbjct: 5 ASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKIGEPGQTHEDLAASL 60 >At3g46000.1 68416.m04977 actin-depolymerizing factor, putative (ADF2) strong similarity to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 137 Score = 44.0 bits (99), Expect = 8e-05 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAEYEQFLEDL 607 ASG+ V D CK + E+K + R +V+ I D KQ+ VE +GE Y+ F L Sbjct: 5 ASGMAVHDDCKLKFMELKAKRTFRTIVYKIED-KQVIVEKLGEPEQSYDDFAASL 58 >At5g59890.2 68418.m07511 actin-depolymerizing factor 4 (ADF4) identical to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana} Length = 132 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 452 VTVSDACKTTYEEIKKDKKHRYVVFYIRD-EKQIDVETVGERNAEYEQFLEDL 607 + V D CK + E+K + HR++V+ I + +KQ+ VE VGE YE F L Sbjct: 1 MAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL 53 >At5g52360.1 68418.m06497 actin-depolymerizing factor, putative strong similarity to pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum] GI:22857914; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 137 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAEYEQF 595 ASG+ V D CK + E+K + +R+++F I D +Q+ VE +G Y+ F Sbjct: 5 ASGMAVEDECKLKFLELKAKRNYRFIIFRI-DGQQVVVEKLGSPQENYDDF 54 >At1g01750.1 68414.m00094 actin-depolymerizing factor, putative strong similarity to SP|P30175 Actin-depolymerizing factor (ADF) {Lilium longiflorum}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 140 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRDEK--QIDVETVGERNAEYEQFLEDL 607 ASG+ VSD CK + E+K + +R++VF I DEK Q+ ++ +G YE F + Sbjct: 5 ASGMHVSDECKLKFLELKAKRNYRFIVFKI-DEKAQQVMIDKLGNPEETYEDFTRSI 60 >At4g00680.1 68417.m00093 actin-depolymerizing factor, putative strong similarity to SP|P30175 Actin-depolymerizing factor (ADF) {Lilium longiflorum}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 140 Score = 43.2 bits (97), Expect = 1e-04 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = +2 Query: 443 ASGVTVSDACKTTYEEIKKDKKHRYVVFYIRDEK--QIDVETVGERNAEYEQFLEDL 607 ASG+ V+D CK + E+K + +R++VF I DEK Q+ +E +G Y+ F + Sbjct: 5 ASGMHVNDECKIKFLELKAKRTYRFIVFKI-DEKAQQVQIEKLGNPEETYDDFTSSI 60 >At2g16700.1 68415.m01916 actin-depolymerizing factor 5 (ADF5) identical to SP|Q9ZNT3 Actin-depolymerizing factor 5 (ADF-5) (AtADF5) {Arabidopsis thaliana} Length = 143 Score = 41.1 bits (92), Expect = 6e-04 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +2 Query: 437 KMAS-GVTVSDACKTTYEEIKKDKKHRYVVFYIRDE-KQIDVETVGERNAEYEQFLED 604 KMA+ G+ V+D C +++ ++K K HRY+VF I ++ +++ V+ VG Y LED Sbjct: 6 KMATTGMRVTDECTSSFMDMKWKKVHRYIVFKIEEKSRKVTVDKVGGAGESYHD-LED 62 >At4g25590.1 68417.m03687 actin-depolymerizing factor, putative strong similarity to pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum] GI:22857914; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 130 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 452 VTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAEYEQFLEDL 607 + V D CK + E+K + +R+++F I D +Q+ VE +G + Y+ F L Sbjct: 1 MAVEDECKLKFLELKSKRNYRFIIFRI-DGQQVVVEKLGNPDETYDDFTASL 51 >At4g34970.1 68417.m04957 actin-depolymerizing factor, putative similar to SP|Q9ZNT3 Actin-depolymerizing factor 5 (ADF-5) (AtADF5) {Arabidopsis thaliana}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 130 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 458 VSDACKTTYEEIKKDKKHRYVVFYIRDE-KQIDVETVGERNAEYEQFLEDL 607 ++D CK ++ E+K K HRYVV+ + ++ +++ V+ VG Y+ L Sbjct: 1 MTDDCKKSFMEMKWKKVHRYVVYKLEEKSRKVTVDKVGAAGESYDDLAASL 51 >At3g45990.1 68416.m04976 actin-depolymerizing factor, putative similar to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 133 Score = 36.7 bits (81), Expect = 0.012 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +2 Query: 452 VTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVE------TVGERNAEYEQFLEDL 607 + + D CK T+ E+K+ + R +V+ I D Q+ VE GER YE+F L Sbjct: 1 MVLHDDCKLTFLELKERRTFRSIVYKIEDNMQVIVEKHHYKKMHGEREQSYEEFANSL 58 >At4g35250.1 68417.m05010 vestitone reductase-related low similarity to vestitone reductase [Medicago sativa subsp. sativa] GI:973249 Length = 395 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 263 YDNFIIKDTVLTSPITLTHALIGCRQKGLTNI 358 + + DTV ++P+T T++L+G QK + + Sbjct: 335 FSEVLSSDTVFSAPMTETNSLLGVDQKDMVTL 366 >At2g33060.1 68415.m04054 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 808 Score = 27.1 bits (57), Expect = 9.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 79 LLDINYQPLKRAVSKSSSDYCYVVVLINLRDNKFD 183 +LD++Y L + + SD+ ++++NLR N + Sbjct: 413 ILDLSYNNLTGPIPRCLSDFQESLIVVNLRKNNLE 447 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,263,035 Number of Sequences: 28952 Number of extensions: 203629 Number of successful extensions: 481 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -