BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0734 (611 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5N568 Cluster: Putative uncharacterized protein; n=1; ... 35 1.8 UniRef50_Q03US3 Cluster: Transcriptional regulator, xre family; ... 34 3.1 UniRef50_Q8IBP7 Cluster: Putative uncharacterized protein MAL7P1... 33 5.3 >UniRef50_A5N568 Cluster: Putative uncharacterized protein; n=1; Clostridium kluyveri DSM 555|Rep: Putative uncharacterized protein - Clostridium kluyveri DSM 555 Length = 401 Score = 34.7 bits (76), Expect = 1.8 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 2/110 (1%) Frame = +1 Query: 184 SSNPNYFYGGEWKNK*R-KIMFTILNN*KIIALTVNMLYYILMAPASTLQFNNDLKKYPT 360 +S P YFY K R K+MF+ LN I + +N ++ L + + + F D Sbjct: 162 NSYPKYFYNSSEKLTFRNKLMFSKLNQKNIKNINMNEVF--LKSNENNIYFKTDHHYNFN 219 Query: 361 GLVLYVLLT*NK*SDQLNHLKN*LTVN-TSICVHFLPTTYVGTRSSNLYE 507 G ++ NK ++ H++ T+ V L T++G+R++ LYE Sbjct: 220 GALMVYQAIINKALEE-EHIRTLSTLKYNDFKVITLNNTFIGSRNNQLYE 268 >UniRef50_Q03US3 Cluster: Transcriptional regulator, xre family; n=1; Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293|Rep: Transcriptional regulator, xre family - Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 /NCDO 523) Length = 183 Score = 33.9 bits (74), Expect = 3.1 Identities = 24/72 (33%), Positives = 39/72 (54%) Frame = -1 Query: 296 YNILTVNAIIFQLFKIVNIIFLHLFFHSPP*K*LGLDEILGIRLILIVFLKIIYILSS*I 117 Y I+T++ I + + +FL LF+ S + ++ L L + +F+ IIYIL+ I Sbjct: 82 YRIVTISLISAIIVGTIGYLFLKLFYSS---NMILIESNLSGYLSIPMFILIIYILTK-I 137 Query: 116 NYHELTIILKIK 81 N+H L IL K Sbjct: 138 NWHSLISILNKK 149 >UniRef50_Q8IBP7 Cluster: Putative uncharacterized protein MAL7P1.106; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL7P1.106 - Plasmodium falciparum (isolate 3D7) Length = 130 Score = 33.1 bits (72), Expect = 5.3 Identities = 21/77 (27%), Positives = 38/77 (49%) Frame = +1 Query: 148 KNTIKISLIPKISSNPNYFYGGEWKNK*RKIMFTILNN*KIIALTVNMLYYILMAPASTL 327 K+ I+ SL+ I S Y++ +K + I+ LNN +++ T+ Y+++ L Sbjct: 41 KSRIRFSLVILIISILMYYF---YKYRNSNIIIETLNNVPLVSFTIIFFYFVIKYDYKNL 97 Query: 328 QFNNDLKKYPTGLVLYV 378 + DL K G LY+ Sbjct: 98 FKSKDLNKTLKGFNLYL 114 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 517,112,258 Number of Sequences: 1657284 Number of extensions: 9276626 Number of successful extensions: 14952 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14948 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43977329078 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -