BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0734 (611 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.7 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.2 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.2 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 426 LANC*HKYLCTLPSYNVCRYTVVKLI*KAQLI 521 L NC + +LC Y +KL+ KA +I Sbjct: 1128 LLNCVYLFLCGFCVYEFASDERIKLVIKAIII 1159 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = +1 Query: 403 DQLNHLKN*LTVNTSICVHFLPTTYVGTRSSNLYE 507 + + LK+ ++ C H + ++G + N YE Sbjct: 1 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYE 35 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = +1 Query: 403 DQLNHLKN*LTVNTSICVHFLPTTYVGTRSSNLYE 507 + + LK+ ++ C H + ++G + N YE Sbjct: 315 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYE 349 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = +1 Query: 403 DQLNHLKN*LTVNTSICVHFLPTTYVGTRSSNLYE 507 + + LK+ ++ C H + ++G + N YE Sbjct: 548 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYE 582 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = +1 Query: 403 DQLNHLKN*LTVNTSICVHFLPTTYVGTRSSNLYE 507 + + LK+ ++ C H + ++G + N YE Sbjct: 548 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYE 582 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,466 Number of Sequences: 336 Number of extensions: 2886 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -