BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0734 (611 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 25 1.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.4 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 7.8 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 25.0 bits (52), Expect = 1.9 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = +1 Query: 127 DSMYIIFKNTIKISLIPKISSNPNYFYGGEW 219 +S+++++++TI ++ + NP+YF W Sbjct: 336 ESLFMVYEHTIDSTVWNAFTRNPDYFVPHFW 366 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 127 DSMYIIFKNTIKISLIPKISSNP 195 D M F ++ +++IPK SNP Sbjct: 3157 DGMISCFGHSSTVTIIPKFESNP 3179 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 268 IIALTVNMLYYILMAPASTLQFNNDLK 348 ++ L + ++YY++ S + N DLK Sbjct: 668 LLVLLILIIYYLISLTGSLREANQDLK 694 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,572 Number of Sequences: 2352 Number of extensions: 10155 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -