BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0731 (421 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2D8Y6 Cluster: PIKK family atypical protein kinase; n=... 32 5.4 UniRef50_Q4X8H7 Cluster: Putative uncharacterized protein; n=1; ... 31 7.2 >UniRef50_A2D8Y6 Cluster: PIKK family atypical protein kinase; n=1; Trichomonas vaginalis G3|Rep: PIKK family atypical protein kinase - Trichomonas vaginalis G3 Length = 2138 Score = 31.9 bits (69), Expect = 5.4 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -2 Query: 171 RGALIHI*ARIKTLNYQNETVH-TQLHSPYSRQRKKFVQK 55 +GAL + A +K LN N+TVH TQ S Y+ Q +K +Q+ Sbjct: 1702 KGALDKLMAFLKLLNDPNKTVHDTQFFSGYATQLQKVLQE 1741 >UniRef50_Q4X8H7 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 48 Score = 31.5 bits (68), Expect = 7.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 267 LAFHI*FCHLHNLLLYFIFFHLCSFTDAKRL 175 + FHI +C++H+ +L F F F D +RL Sbjct: 16 IGFHIKYCYMHSCMLSFFVFLTFFFVDKERL 46 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,755,335 Number of Sequences: 1657284 Number of extensions: 5566107 Number of successful extensions: 10046 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10042 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 19389441554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -