BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0727 (577 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128809-1|BAC87616.1| 404|Homo sapiens protein ( Homo sapiens ... 31 3.8 AY158091-1|AAN46899.1| 346|Homo sapiens oocyte-specific histone... 29 8.9 AK130563-1|BAC85380.1| 158|Homo sapiens protein ( Homo sapiens ... 29 8.9 >AK128809-1|BAC87616.1| 404|Homo sapiens protein ( Homo sapiens cDNA FLJ45978 fis, clone PROST2007444. ). Length = 404 Score = 30.7 bits (66), Expect = 3.8 Identities = 26/77 (33%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Frame = -2 Query: 336 CAQVEERLLVKAPPPWGQADCFLKSMADCR*A*ECHY-LQRISKKNQAVLRMVLRA---- 172 CA VE RLL P W A ++ A+C A C + S R++ RA Sbjct: 98 CADVECRLLTHVPM-WS-ARLLTRADAECPPAHTCRCGVPACSHVPMRSARLLTRAHAEC 155 Query: 171 PPTGDCRRGEPVAAQWP 121 PP CRRG P + P Sbjct: 156 PPAHTCRRGVPACSHVP 172 >AY158091-1|AAN46899.1| 346|Homo sapiens oocyte-specific histone H1 protein. Length = 346 Score = 29.5 bits (63), Expect = 8.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 216 ISKKNQAVLRMVLRAPPTGDCRRGEPVAA 130 + +++ VLRMVL A G+ RRG VAA Sbjct: 48 VGRRHPPVLRMVLEALQAGEQRRGTSVAA 76 >AK130563-1|BAC85380.1| 158|Homo sapiens protein ( Homo sapiens cDNA FLJ27053 fis, clone SPL00486. ). Length = 158 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 101 CGIATRTGHCAATGSPRRQS 160 CGI TRT HC TG R Q+ Sbjct: 125 CGIDTRTDHCNQTGQKRVQN 144 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,754,894 Number of Sequences: 237096 Number of extensions: 1886609 Number of successful extensions: 5193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5193 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -