BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0725 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.1 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 23 2.0 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 3.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 4.6 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 4.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.1 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 256 SRHNQADRMAPSAAQEFVKNVRGKPKRH 339 +RH +AD S + E N R P+ H Sbjct: 242 TRHREADDAEESVSSETNHNERSTPRSH 269 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 256 SRHNQADRMAPSAAQEFVKNVRGKPKRH 339 +RH +AD S + E N R P+ H Sbjct: 242 TRHREADDAEESVSSETNHNERSTPRSH 269 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 256 SRHNQADRMAPSAAQEFVKNVRGKPKRH 339 +RH +AD S + E N R P+ H Sbjct: 242 TRHREADDAEESVSSETNHNERSTPRSH 269 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 23.0 bits (47), Expect = 2.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 244 RHFQSRHNQADRM 282 RHFQ +H Q+D + Sbjct: 23 RHFQDKHEQSDTL 35 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 22.2 bits (45), Expect = 3.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 464 HPPKGFVNILDEVVIYNDP 520 +PPKG + +V++ N P Sbjct: 332 NPPKGAADFTAQVIVLNHP 350 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 229 RPKSSRHFQSRHNQADRMAPSAAQEFVKNVRGKPK 333 RPK + + Q D AP+A + V+ V KP+ Sbjct: 365 RPKLRKDMYEKMVQVDPTAPNAEERRVQGVT-KPR 398 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 229 RPKSSRHFQSRHNQADRMAPSAAQEFVKNVRGKPK 333 RPK + + Q D AP+A + V+ V KP+ Sbjct: 280 RPKLRKDMYEKMVQVDPTAPNAEERRVQGVT-KPR 313 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 229 RPKSSRHFQSRHNQADRMAPSAAQEFVKNVRGKPK 333 RPK + + Q D AP+A + V+ V KP+ Sbjct: 599 RPKLRKDMYEKMVQVDPTAPNAEERRVQGVT-KPR 632 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NLLRMYEENQNVMVEALHKDLRRSKMEAILLEVDYLIN 415 N+L Y ++ + V AL KM+ + +EV Y I+ Sbjct: 314 NILLYYRDSLALSVFALILTALLRKMQEMSIEVPYWIS 351 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 398 VDYLINDLRNTLHYLDEWTKPEHP 469 V+ + N LRN L + P+HP Sbjct: 359 VERMHNKLRNALQTVLAQNHPQHP 382 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,103 Number of Sequences: 438 Number of extensions: 2955 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -