BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0720 (654 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0004 + 26990250-26990516,26990877-26990931,26991286-269914... 29 4.3 01_05_0502 + 22771428-22771466,22772327-22772430,22773043-227731... 28 5.6 >05_07_0004 + 26990250-26990516,26990877-26990931,26991286-26991461, 26991702-26991923,26992001-26992239,26992437-26992962, 26993042-26993315,26993391-26994009,26994082-26994121, 26994263-26994310,26994548-26994814,26994892-26995155, 26995260-26995904 Length = 1213 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -2 Query: 395 YFDYF*IVKYASKRISTDLGFSRQIMLNIIERIL*SRPASRNKTSECTWHVVEGRIFSFF 216 YF F ++ + ++S G+S ++NI+ I+ A + T CT EGRI ++ Sbjct: 283 YFSSFGLIVWYGSKLSLSRGYSGADIMNILFGIMIGARALGDAT-PCTAAFEEGRIAAYR 341 Query: 215 FF 210 F Sbjct: 342 LF 343 >01_05_0502 + 22771428-22771466,22772327-22772430,22773043-22773129, 22773212-22773287,22773393-22773467,22773639-22773692, 22773745-22773918,22774002-22774061,22774135-22774251, 22774448-22774542,22774811-22775013,22775177-22775274, 22775451-22775587,22776154-22776219,22776300-22776465, 22776537-22776659,22776763-22776845,22776943-22777084, 22777334-22777363,22777587-22777657,22777742-22778333 Length = 863 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 244 TCQVHSDVLLREAGRDHKILSIIFSIIWRENPRS 345 TC++ DV+LR D +++ ++FS + ++P S Sbjct: 87 TCEI--DVILRTLVEDEQLMELLFSFVKSDHPHS 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,087,159 Number of Sequences: 37544 Number of extensions: 221944 Number of successful extensions: 282 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -