BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0720 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) 28 5.8 SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) 28 5.8 >SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) Length = 908 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Frame = -1 Query: 567 CNYATNNVVLQQKLHHQTNIF------SSSKYLG*GNTILIFIVPD 448 C T N + HQT++F ++ +Y G NT+L F +PD Sbjct: 594 CTIPTPNYTFAKPKPHQTSLFRTLEHYTTLRYSGPSNTLLHFAIPD 639 >SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) Length = 958 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Frame = -1 Query: 567 CNYATNNVVLQQKLHHQTNIF------SSSKYLG*GNTILIFIVPD 448 C T N + HQT++F ++ +Y G NT+L F +PD Sbjct: 543 CTIPTPNYTFAKPKPHQTSLFRTLEHYTTLRYSGPSNTLLHFAIPD 588 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,085,328 Number of Sequences: 59808 Number of extensions: 286121 Number of successful extensions: 376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -