BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0720 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 3.4 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.4 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 7.9 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 603 N*HNYMLLYRYKCNYATNNVVLQQKLHHQTNIFS 502 N +NY Y K NY NN +KL+++ I + Sbjct: 92 NNNNYKYNYNNKYNYNNNN--YNKKLYYKNYIIN 123 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 36 KNNIYFYVVIRNKPVSVELNII 101 + +I FY++IR K + +N+I Sbjct: 220 ETDITFYIIIRRKTLFYTVNLI 241 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 83 THRFISDHHIKINIVFENYTYVHN 12 T IS HIK+ +V ++ + HN Sbjct: 394 TSTTISQKHIKVFVVNKDILHEHN 417 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,046 Number of Sequences: 438 Number of extensions: 3175 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -