BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0719 (554 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 48 5e-06 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 39 0.002 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 38 0.004 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 36 0.017 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 35 0.039 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 34 0.068 SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 34 0.068 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 34 0.068 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 31 0.48 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_46386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_23434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 27 7.8 >SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 61.3 bits (142), Expect = 5e-10 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = +1 Query: 346 TPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQVPI 495 T +ENR+Y+LKI CG YP +PPT +F+S+I+MN VNS+ G D+R+ + Sbjct: 1 TVFENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSK-GETDDREAEL 49 >SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 58.4 bits (135), Expect = 4e-09 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = +1 Query: 346 TPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQ 462 T +ENR+Y+LKI CG YP +PPT +F+S+I+MN VNS+ Sbjct: 1 TVFENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSK 39 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 48.0 bits (109), Expect = 5e-06 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +1 Query: 328 IIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNSQTGLVDNRQVPILAR 504 +IG TPY ++ L I+ RYP EPP RF++ I H N +S +D ++P Sbjct: 2 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGM 61 Query: 505 WQRDYTIKTVLQEV 546 W+ I +VL + Sbjct: 62 WKPALNISSVLSTI 75 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 44.4 bits (100), Expect = 6e-05 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 295 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 447 DD L W M++GPP T YE + + YP PPT FIS I H N Sbjct: 358 DDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFISDIWHPN 409 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 39.1 bits (87), Expect = 0.002 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 10/98 (10%) Frame = +1 Query: 283 LESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN---- 447 +E D+ W I GPP T Y + + YP PPT RF++++ H N Sbjct: 1146 VEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDYPYSPPTFRFLTKMWHPNIYES 1205 Query: 448 ---CVNSQTGLVDNRQVPIL--ARWQRDYTIKTVLQEV 546 C++ VD+ Q L RW ++T+L V Sbjct: 1206 GDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSV 1243 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 38.3 bits (85), Expect = 0.004 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = +1 Query: 298 DMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPP 414 D T T G I GPP TP+E Y+L I YP PP Sbjct: 683 DETFTKLKGEIRGPPETPFEGGTYNLDIVIPETYPFNPP 721 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 325 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 432 MI GP TPY++ +++ I YPD PP+ ++S Sbjct: 639 MIEGPAGTPYDHGLFAFDILLPANYPDAPPSFHYLS 674 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 35.1 bits (77), Expect = 0.039 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 307 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPP 414 L W I+GPP + YE ++ L I T YP +PP Sbjct: 51 LYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPP 86 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 34.3 bits (75), Expect = 0.068 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 274 SWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPP 414 S G + DD L W I+GPP + YE ++ L I + YP +PP Sbjct: 156 SAGPKGDD---LYEWYSTILGPPGSVYEGGVFFLDIHFPSDYPFKPP 199 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 34.3 bits (75), Expect = 0.068 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 274 SWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPP 414 S G + DD L W I+GPP + YE ++ L I + YP +PP Sbjct: 116 SAGPKGDD---LYEWYSTILGPPGSVYEGGVFFLDIHFPSDYPFKPP 159 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 34.3 bits (75), Expect = 0.068 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 295 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 441 D+ + +W G+I+ P PY + ++I YP +PP F ++I+ Sbjct: 19 DESNILYWQGLIV-PEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIY 66 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 295 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 432 DD+ H +I GP TPYE + I C YP PP + ++ Sbjct: 8 DDIPKIH--ALITGPFDTPYEGGFFYFLIRCPPDYPIRPPRVKLMT 51 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 31.5 bits (68), Expect = 0.48 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +1 Query: 307 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQ 486 L W + GPP T + Y +I YP +PP+ ++ + + L + Sbjct: 38 LFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLTPNGRFEIGKKICLSMSAH 97 Query: 487 VPILARWQRDYTIKTVLQEV 546 P WQ ++I+TVL + Sbjct: 98 HP--ETWQPSWSIRTVLMAI 115 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 31.5 bits (68), Expect = 0.48 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 355 ENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNSQTGLVDNRQVPILARWQRDYTIKT 531 ENR+ K+E T P EPP RF++ I H N +S +D ++P W+ I + Sbjct: 29 ENRID--KLEAST--PFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISS 84 Query: 532 VLQEV 546 VL + Sbjct: 85 VLSTI 89 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 6/68 (8%) Frame = +1 Query: 268 TISWG-LESDDDMT----LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPT-ARFI 429 T S+G +ES ++T L + GP TPYE ++ ++++ +YP + P+ A F Sbjct: 29 TDSFGRIESKHEVTILGGLNEFIVKFFGPVGTPYEGGVWKVRVDLPEKYPFKSPSIANFT 88 Query: 430 SRIHMNCV 453 I + CV Sbjct: 89 IEISV-CV 95 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 525 DGIVTLPSSKNWDLSIIHKSSLTIDTVHMNPRNKAGC 415 + + L SS+N +++HK T+D + RN GC Sbjct: 3867 ESVTALESSENAVATLMHKIDGTLDNLSDEDRNSIGC 3903 >SB_46386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 510 LPSSKNWDLSIIHKSSLTIDTVHM-NPRNKAGCWWLI 403 LPS+K W +I H SL V + +P N WW + Sbjct: 789 LPSTKGWKNAIRHTLSLRQRFVRLPDPGNPYRSWWTV 825 >SB_23434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.9 bits (59), Expect = 5.9 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -3 Query: 426 KAGCWWLIRVSCSTFNFKGVHSILVGCPW 340 + GC W++ C ++ ++VGC W Sbjct: 20 ECGCGWVVAAECGCGGCGQLNVVVVGCGW 48 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = -3 Query: 429 NKAGCWWLIRVSCSTFNFKGVHSILVGCPWWANNHSSPMSKSHIIIAFKTPRNGSIAH 256 N + C W++ ++ S + ILV CP +S M + F NG ++H Sbjct: 189 NPSSCHWMLDLASSNLSLSSGAKILVSCPINLTANSLTMQTNS---QFNIFGNGKVSH 243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,537,250 Number of Sequences: 59808 Number of extensions: 355906 Number of successful extensions: 924 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -