BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0719 (554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding pr... 23 6.7 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 8.9 >AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding protein OBPjj83a protein. Length = 285 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 430 SRIHMNCVNSQTGLVDNRQVPILA 501 +R + CV +TGL D+ Q P +A Sbjct: 199 TRSLIRCVGIRTGLYDDEQGPNIA 222 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 8.9 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 390 STFNFKGVHSI-LVGCPWWANNHSSPMSKSHIIIAFKTPRNGSIAHSLL 247 S F+ + + I GCPW +H P + + AF P+ A +++ Sbjct: 872 SMFHIQNAYRIPSSGCPWMGLSHKLPSNTA--FRAFGGPQGMMAAETMM 918 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,266 Number of Sequences: 2352 Number of extensions: 11963 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -