BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0714 (588 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0466 + 3607947-3610608,3610725-3611018,3611494-3611895,361... 29 2.1 07_03_1291 + 25545749-25546262,25546989-25547669,25547693-255477... 29 2.7 11_04_0014 - 12253341-12253358,12253520-12253729,12254388-122545... 28 4.8 06_03_0157 + 17337641-17337896,17337975-17338082,17338643-173389... 28 4.8 02_01_0090 - 637141-640263 28 6.3 01_05_0176 - 18957676-18958067,18958139-18958242,18958358-189584... 28 6.3 10_08_0887 - 21311301-21311828,21312001-21312110,21312215-21312392 27 8.4 >11_01_0466 + 3607947-3610608,3610725-3611018,3611494-3611895, 3611984-3612217,3614113-3614138,3614446-3614633, 3615707-3617670,3617938-3618423,3618527-3618894 Length = 2207 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 319 EAFEKCLKSGLTVFAQCAAATPVPLLNAMTEVGKSGS 429 E CL S L + C ++P+P+L A + + SG+ Sbjct: 964 ETATHCLLSVLNIGLCCTKSSPIPILTACSSIDSSGN 1000 >07_03_1291 + 25545749-25546262,25546989-25547669,25547693-25547751, 25549152-25549242,25549330-25549743,25550191-25550243, 25550947-25551177,25551492-25551708,25551790-25551890, 25552446-25552532,25553536-25553676,25553839-25553961, 25554070-25554522,25554931-25555308,25555410-25556060, 25556264-25556368,25556482-25556707,25557204-25557241 Length = 1520 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -2 Query: 479 YAASFSVCIWTTLMSRNDPLF---PTSVMA-LRRGTGVAAAHWANTVSPDLR 336 + + F +C+WT R+D +F P S+ A L+RG + WA +PD R Sbjct: 341 FQSFFLLCLWTLWNHRHDVVFRERPPSISACLQRGLSESTL-WAAMFTPDDR 391 >11_04_0014 - 12253341-12253358,12253520-12253729,12254388-12254523, 12254631-12254752,12254789-12254842,12254872-12255161, 12255737-12255948,12256008-12256475,12256560-12256856, 12257467-12258329,12258417-12258490,12258616-12258650, 12259024-12259087,12259452-12259733,12259870-12259946, 12260045-12260325 Length = 1160 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 Query: 412 LRSWH*EEAPAWRPRTGRTRSVRI*DISQTPPLRSNIQASCPG 284 L SW P W G+ + + + D P + QA CPG Sbjct: 160 LSSWMDGCEPGWACTVGKEQKINLQDAKDIPYRALDCQACCPG 202 >06_03_0157 + 17337641-17337896,17337975-17338082,17338643-17338908, 17339933-17340021,17340095-17340198,17340403-17340508, 17340600-17340675,17340772-17340883,17341719-17342250, 17343097-17343131,17343924-17343984,17344054-17344132, 17344266-17344349 Length = 635 Score = 28.3 bits (60), Expect = 4.8 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 136 VKLNLNNRMSVITKIVPQVSSLHFGKLSSAFLSVKSDRSYFTYTQSLSQ 282 +KL+ + +I+P + L FG + SAF + +D F Y QSL + Sbjct: 232 IKLHSKLERKKMHRIIP--NRLTFGSVRSAFDDIDADDPDFLYIQSLGE 278 >02_01_0090 - 637141-640263 Length = 1040 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 361 AQCAAATPVPLLNAMTEVGKSGSLRDIKVV----HMHTEKDA 474 A+ AAA P + EVG G LR +V +MH E DA Sbjct: 748 AEAAAAAPELTAEVLKEVGLLGRLRHRNIVRLLGYMHNEADA 789 >01_05_0176 - 18957676-18958067,18958139-18958242,18958358-18958483, 18959495-18959628,18959757-18959894,18960835-18960964, 18961316-18961357,18964741-18965024 Length = 449 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = -2 Query: 437 SRNDPLFPTSVMALRRGTGVAAA--HWANTVSPDLRHFSNASFAVEYSGFLSRGC 279 S + P +V A+ T AAA A +VS LRH+ F + + +GC Sbjct: 45 SSSAPTIAAAVPAVAEATAAAAAVSRQAGSVSDALRHYGRCYFELSKARLSFQGC 99 >10_08_0887 - 21311301-21311828,21312001-21312110,21312215-21312392 Length = 271 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 316 LRSNIQASCPGAATTIVYT*SNFYPI 239 +R N SC G T++ T N+YP+ Sbjct: 97 IRCNKDPSCSGNIETVIITDMNYYPV 122 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,108,177 Number of Sequences: 37544 Number of extensions: 335386 Number of successful extensions: 976 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -