BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0711 (472 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.35 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.0 bits (52), Expect = 0.35 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -2 Query: 345 VCL-RFLCGFI*VLAFLLPVYSHYYINFKTLLLHCVEYNNIYI 220 +C+ F C FI LL + + N L L C++Y +++ Sbjct: 164 LCIYHFFCAFIIFTMHLLFCCAFIFFNMHLLFLLCLDYFTLHL 206 Score = 23.4 bits (48), Expect = 1.1 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 Query: 339 LRFLCGFI*VLAFLLPVYSHYYINFKTLLLHCVEY 235 L F C FI LL + YY ++L C+ Y Sbjct: 266 LLFCCAFIIFTMHLLFLLCIYYFYCALIILLCIYY 300 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,492 Number of Sequences: 336 Number of extensions: 1961 Number of successful extensions: 8 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -