BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0711 (472 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084197-6|AAO38572.1| 328|Caenorhabditis elegans Serpentine re... 29 1.3 Z81536-6|CAB04370.1| 352|Caenorhabditis elegans Hypothetical pr... 27 9.0 >AC084197-6|AAO38572.1| 328|Caenorhabditis elegans Serpentine receptor, class v protein25 protein. Length = 328 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 Query: 339 LRFLCGFI*VLAFLLPVYSHYYINFKTLLLHCVEYNNIYIT 217 L + F+ + A +P+ +Y N++ + YN+IY T Sbjct: 62 LAMMMYFVIIAARAIPIIREFYFNYQDYYIAAAAYNHIYYT 102 >Z81536-6|CAB04370.1| 352|Caenorhabditis elegans Hypothetical protein F40D4.8 protein. Length = 352 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = -2 Query: 330 LCGFI*VLAFLLPVYSHYYINFKT 259 +C F +++F++ + S +YIN+KT Sbjct: 62 ICDFSQMISFVVVMTSQFYINYKT 85 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,043,189 Number of Sequences: 27780 Number of extensions: 154674 Number of successful extensions: 363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 850313440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -