BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0709 (606 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0151 - 5035572-5035954,5036309-5036324,5036420-5037040 29 2.2 10_08_0416 + 17770384-17770992 28 5.0 >09_02_0151 - 5035572-5035954,5036309-5036324,5036420-5037040 Length = 339 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 184 CCFELIVVADNFGVATYAIFLF 249 CCF ++VA G A YA+FL+ Sbjct: 28 CCFLFLIVAALAGAAAYALFLY 49 >10_08_0416 + 17770384-17770992 Length = 202 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 196 LIVVADNFGVATYAIFLFALTIWWSVNWGDATACPYTHIE 315 ++VV FGV A+ ++ + WSV GDA A P + E Sbjct: 129 VVVVGILFGVGCGALTAASMYLVWSVLAGDAAAAPSPYDE 168 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,075,545 Number of Sequences: 37544 Number of extensions: 352966 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -