Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0707
         (521 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0151 + 1206555-1206998,1207112-1207543                           29   2.3  

>03_01_0151 + 1206555-1206998,1207112-1207543
          Length = 291

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +2

Query: 218 LAPMNNSLYTTRSAAANYRRRHIGLGCSDECLPLHPYTAADLHETCNTQ 364
           LA ++ ++        + R+RH        C P  P    DL E+C TQ
Sbjct: 25  LALLHGAMEADGGGGGDGRKRHAAAAAFASCCPCPPVADLDLLESCVTQ 73


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,390,794
Number of Sequences: 37544
Number of extensions: 219419
Number of successful extensions: 362
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 362
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1142636160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)