Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0707
         (521 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z19158-1|CAA79574.1|  788|Caenorhabditis elegans Hypothetical pr...    27   8.1  

>Z19158-1|CAA79574.1|  788|Caenorhabditis elegans Hypothetical
           protein T23G5.1 protein.
          Length = 788

 Score = 27.1 bits (57), Expect = 8.1
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%)
 Frame = +2

Query: 242 YTTRSAAANYRRRHIGLG---CSDECLPLHPYTAADLHETCNTQT---KKFETI*QKLHF 403
           Y T   AAN +     LG   CS+ C  +  Y+A D    CN  +    ++ T  +K  F
Sbjct: 410 YITYKDAANRKSNQQNLGTIKCSNLCTEIIEYSAPDEIAVCNLASIALNRYVTPEKKFDF 469

Query: 404 IK 409
           +K
Sbjct: 470 VK 471


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,159,422
Number of Sequences: 27780
Number of extensions: 213257
Number of successful extensions: 451
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 444
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 451
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1017709248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)