BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0706 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 25 0.38 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 2.0 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.0 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.0 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 21 6.1 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 21 6.1 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 25.4 bits (53), Expect = 0.38 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 162 YVLRFLPTSFHSQLKVGTEPVKLIPARYGDDVMTRPNVGPSDGTK 28 YVL+F S +S + TE + A +GDDV N+G D ++ Sbjct: 417 YVLKFEYRSMNSWFEHETESGRNFGAAHGDDVPYIFNMGLFDTSR 461 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 326 ETEGYIFWSKLNTSVHKI 273 E EG+ FW K +V K+ Sbjct: 37 ELEGFNFWGKYQKAVEKL 54 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 326 ETEGYIFWSKLNTSVHKI 273 E EG+ FW K +V K+ Sbjct: 197 ELEGFNFWGKYQKAVEKL 214 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 326 ETEGYIFWSKLNTSVHKI 273 E EG+ FW K +V K+ Sbjct: 197 ELEGFNFWGKYQKAVEKL 214 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 6.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 162 YVLRFLPTSFHSQLKVGTEPVKLIPARYGDDVMTRPNVGPSDGTK 28 Y L+F S +S + TE + A + DDV N+G D ++ Sbjct: 417 YALKFEYRSMNSWFEHETESGRNFGAAHADDVPYIFNMGLFDTSR 461 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 6.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 162 YVLRFLPTSFHSQLKVGTEPVKLIPARYGDDVMTRPNVGPSDGTK 28 Y L+F S +S + TE + A + DDV N+G D ++ Sbjct: 417 YALKFEYRSMNSWFEHETESGRNFGAAHADDVPYIFNMGLFDTSR 461 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,548 Number of Sequences: 336 Number of extensions: 3738 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -