BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0704 (649 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-941|AAF50791.1| 253|Drosophila melanogaster CG10677-PA... 29 4.1 >AE014296-941|AAF50791.1| 253|Drosophila melanogaster CG10677-PA protein. Length = 253 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 39 NKAKTINISSVNLMSNIEQGSNGGANIKPVARPSIHYHKG 158 NK T++ S S + +G GG I+ R H+H G Sbjct: 60 NKGLTLDFRSSTGASTLRRGKRGGDGIRGEGRAHAHWHAG 99 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,647,898 Number of Sequences: 53049 Number of extensions: 545572 Number of successful extensions: 1440 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1440 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2744900550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -