BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0699 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 7.2 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 9.5 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 9.5 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 9.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.5 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 7.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 96 ESASSLTSVPVCKDS*SSTPSVEVPALGSLPY*WS 200 +S SS V ++S SS+PS+++ G L WS Sbjct: 357 QSQSSPKFVARREESNSSSPSLDLGKEGGLEAQWS 391 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 595 GKLFMVALLGRDDWRVRDQ 539 G LF++ L W++RD+ Sbjct: 1 GSLFLLLLSTSHGWQIRDR 19 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 595 GKLFMVALLGRDDWRVRDQ 539 G LF++ L W++RD+ Sbjct: 6 GSLFLLLLSTSHGWQIRDR 24 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 595 GKLFMVALLGRDDWRVRDQ 539 G LF++ L W++RD+ Sbjct: 6 GSLFLLLLSTSHGWQIRDR 24 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +3 Query: 486 TSPSSRLTWCLTPVSTS 536 TSP+S + C++P++ S Sbjct: 582 TSPNSAVRKCMSPINGS 598 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/35 (28%), Positives = 13/35 (37%) Frame = -2 Query: 130 QTGTLVSELADSVQNQIYDFLLQWCSDHGHSCWPH 26 Q G + D + Y + C D G WPH Sbjct: 551 QQGDTCCWVCDQCEEYEYVYDEYTCMDCGPGKWPH 585 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,416 Number of Sequences: 438 Number of extensions: 3348 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -