BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0697 (477 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF263523-1|AAG28029.1| 871|Homo sapiens vanilloid receptor-rela... 29 6.3 >AF263523-1|AAG28029.1| 871|Homo sapiens vanilloid receptor-related osmotically activated channel protein. Length = 871 Score = 29.5 bits (63), Expect = 6.3 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -2 Query: 431 LDVEWSMTVAKRKSNTATSRHGTLHVAGRFSRGKVNDKWAGARRHVNWQH 282 LD+E S V RK+ R G + G+ S G + +W VNW H Sbjct: 742 LDIERSFPVFLRKA----FRSGEMVTVGKSSDGTPDRRWCFRVNEVNWSH 787 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,025,027 Number of Sequences: 237096 Number of extensions: 1366611 Number of successful extensions: 2991 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2990 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -