BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0686 (610 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20190.1 68416.m02559 leucine-rich repeat transmembrane prote... 27 9.7 >At3g20190.1 68416.m02559 leucine-rich repeat transmembrane protein kinase, putative similar to receptor kinase GB:AAA33715 [Petunia integrifolia] Length = 679 Score = 27.1 bits (57), Expect = 9.7 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = -2 Query: 609 ISKFINTTYLLVVICQLMFLRIPICVVGHGLRVNVALVTFAFTVLVEFEVGIIICRD-CN 433 ++K + L V+I +L+ R P + G N++LVT+ ++ E + G + ++ Sbjct: 548 LTKKTDVWCLGVLILELLTGRFPENYLSQGYDANMSLVTWVSNMVKEKKTGDVFDKEMTG 607 Query: 432 KNEL*CTILNSIRMG 388 K +LN +++G Sbjct: 608 KKNCKAEMLNLLKIG 622 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,780,323 Number of Sequences: 28952 Number of extensions: 181446 Number of successful extensions: 259 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -