BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0679 (604 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77110.1 68414.m08981 auxin transport protein, putative simil... 31 0.78 At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding ... 29 2.4 At5g24380.1 68418.m02874 transporter, putative similar to iron-p... 28 5.5 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 27 7.2 At2g10070.2 68415.m01044 expressed protein very low similarity t... 27 7.2 At2g10070.1 68415.m01045 expressed protein very low similarity t... 27 7.2 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 9.6 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 9.6 At1g72610.1 68414.m08396 germin-like protein (GER1) identical to... 27 9.6 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 27 9.6 >At1g77110.1 68414.m08981 auxin transport protein, putative similar to auxin transport protein EIR1 GI:3377507 from [Arabidopsis thaliana] Length = 570 Score = 30.7 bits (66), Expect = 0.78 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 238 TGSSHSDKEVDALTPEKSVAMRGSTAASGTVLVAPGGAT 354 +G H+ K+++ PEK ++ R + A+ A GGA+ Sbjct: 344 SGQRHAAKDINGSVPEKEISFRDALKAAPQATAAGGGAS 382 >At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding subunit (ClpC) identical to AtClpC GI:5360574 from [Arabidopsis thaliana]; contains Pfam profiles PF02861: Clp amino terminal domain and PF02151: UvrB/uvrC motif Length = 952 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = +1 Query: 184 QTTVNTGQPLHSQDSNMSTGSSHSDKEVDALTPEKSVAMRGSTAASGTVLVAPGGATPT 360 Q T + + SQD M+ SH D+E++ +V RG A GG T T Sbjct: 537 QITKEKNEAVRSQDFEMA--GSHRDREIELKAEIANVLSRGKEVAKAENEAEEGGPTVT 593 >At5g24380.1 68418.m02874 transporter, putative similar to iron-phytosiderophore transporter protein yellow stripe 1 [Zea mays] GI:10770865; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 652 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 199 TGQPLHSQDSNMSTGSSHSDKEVDALTPEKSVAMRGS 309 TG+ HS+ S ++ S++S KE D L E V +R S Sbjct: 329 TGRSFHSRLSKTNSISTYSTKESDNLKRENEVFVRES 365 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 277 LKHQLLYHYEMTLCSYWSPDCVAVAPC 197 LKH L+ H++ + WSPD V C Sbjct: 311 LKHTLVGHHKPVIAILWSPDDRQVLTC 337 >At2g10070.2 68415.m01044 expressed protein very low similarity to AHM1 [Triticum aestivum] GI:6691467 Length = 208 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 487 PSSSPVRHAGAKSPSPQGANY 549 PSSSP++++ A PS QG N+ Sbjct: 85 PSSSPLQNSHASYPSSQGNNF 105 >At2g10070.1 68415.m01045 expressed protein very low similarity to AHM1 [Triticum aestivum] GI:6691467 Length = 150 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 487 PSSSPVRHAGAKSPSPQGANY 549 PSSSP++++ A PS QG N+ Sbjct: 85 PSSSPLQNSHASYPSSQGNNF 105 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 181 PQTTVNTGQPLHSQDSNMSTGSSHSDKEVDALTPEKSVAMRGSTAAS 321 PQ + TG+P+ + S+ + L ++ GSTAAS Sbjct: 480 PQLGILTGKPMDETSQTLGNDVSYPSSKSPDLAKSTGQSLSGSTAAS 526 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 181 PQTTVNTGQPLHSQDSNMSTGSSHSDKEVDALTPEKSVAMRGSTAAS 321 PQ + TG+P+ + S+ + L ++ GSTAAS Sbjct: 480 PQLGILTGKPMDETSQTLGNDVSYPSSKSPDLAKSTGQSLSGSTAAS 526 >At1g72610.1 68414.m08396 germin-like protein (GER1) identical to germin-like protein subfamily 3 member 1 SP|P94040; contains Pfam profile: PF01072 Germin family Length = 208 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 365 VMVGVAPPGATRTVPDAAVEPRIATDFSGV 276 V G+ PG T + +AAV P A F G+ Sbjct: 50 VFSGLGTPGNTTNIINAAVTPAFAAQFPGL 79 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 27.1 bits (57), Expect = 9.6 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = +1 Query: 121 ETHRAPEFKMMSAGSQIQMAPQTTVNTGQ-PLHSQDSNMSTGSSHSD--KEVDALTPEKS 291 E+++AP + A + +Q AP T+ T Q P S +SN S + + + V A TP S Sbjct: 709 ESYQAPNLSPVQAPTPVQ-APTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTP-NS 766 Query: 292 VAMRGSTAASGTV 330 ++ T +S V Sbjct: 767 KPVQSPTPSSEPV 779 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,159,959 Number of Sequences: 28952 Number of extensions: 225642 Number of successful extensions: 781 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -