BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0677 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 26 0.68 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.1 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 2.8 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 26.2 bits (55), Expect = 0.68 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 183 PEPVHPQHVPRAPRGRRR 236 P+P P V RAPR RR Sbjct: 163 PQPARPYRVRRAPRAERR 180 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.1 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +3 Query: 3 SARGSAHLPCRVPVAEHPPGRGARRDRAVPGRTHH 107 S+ + + +P +HPPG G + +P + H Sbjct: 219 SSPSGSRMEYLLPHQQHPPGAGVQGAGPIPSQQKH 253 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 24.2 bits (50), Expect = 2.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 94 VVLIMALFGHCGLMSPFVYYYFVT 165 V +MAL + L PF Y+ +VT Sbjct: 149 VAFVMALERYIALAKPFFYHKYVT 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 456,630 Number of Sequences: 2352 Number of extensions: 8324 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -