BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0677 (531 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032626-27|CAA21541.1| 271|Caenorhabditis elegans Hypothetical... 74 6e-14 AC006834-8|AAF40006.1| 865|Caenorhabditis elegans Hypothetical ... 29 1.6 >AL032626-27|CAA21541.1| 271|Caenorhabditis elegans Hypothetical protein Y37D8A.17 protein. Length = 271 Score = 74.1 bits (174), Expect = 6e-14 Identities = 36/95 (37%), Positives = 54/95 (56%) Frame = +1 Query: 40 QSRNILRAAALAEIVLFPVVLIMALFGHCGLMSPFVYYYFVTWRYASRRNPYTRNTFREL 219 Q++N L A +EI L P+++ + G L+ PF YY F++ RYASRRNP TR F ++ Sbjct: 176 QTQNALGIIACSEIFLVPLLVSLIFSGKGSLLLPFAYYRFLSLRYASRRNPSTRQAFAQM 235 Query: 220 RVAADGLTQRPWVPAALASALRSAIDIVCRMAPPV 324 R + + P ++S + AID + APPV Sbjct: 236 RGSLQNVAMSSSCPRPISSLIYRAIDFISARAPPV 270 >AC006834-8|AAF40006.1| 865|Caenorhabditis elegans Hypothetical protein ZK973.2 protein. Length = 865 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -3 Query: 79 SRRAPRPGGCSATGTRHGR*A-DPRA 5 S ++PRPGG S + RHG A DPR+ Sbjct: 832 SSKSPRPGGPSTSSHRHGSHANDPRS 857 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,804,589 Number of Sequences: 27780 Number of extensions: 177155 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -