BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0677 (531 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 32 0.003 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 3.4 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 4.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 4.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 4.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 4.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 4.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 4.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 4.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 4.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 4.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 4.5 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 7.9 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 7.9 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 7.9 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 7.9 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 7.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.9 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 32.3 bits (70), Expect = 0.003 Identities = 21/40 (52%), Positives = 23/40 (57%) Frame = +3 Query: 81 RAVPGRTHHGIVRSLRLDESVRILLLRDVEVRVAPEPVHP 200 R V G GIVRSL LD+ RI+LL E R EPV P Sbjct: 302 RGVRGTRVPGIVRSLVLDKLARIVLLNFQEER-RSEPVEP 340 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 16 LLISRVEFQSRNILRAAALAEIVLFPVVLIMALFGHCG 129 L I V Q L ++ IVL ++ +++ FG CG Sbjct: 35 LQILGVSKQIETGLAFPSITLIVLGSIIFVISFFGCCG 72 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 85 LSNNYNYNNYNNNY 98 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 85 LSNNYNYNNYNNNY 98 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 85 LSNNYNYNNYNNNY 98 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 85 LSNNYNYNNYNNNY 98 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 318 LSNNYNYNNYNNNY 331 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 318 LSNNYNYNNYNNNY 331 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 318 LSNNYNYNNYNNNY 331 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 318 LSNNYNYNNYNNNY 331 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 318 LSNNYNYNNYNNNY 331 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 477 LGNNLHYNNLKNIY 518 L NN +YNN N Y Sbjct: 307 LSNNYNYNNYNNNY 320 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.0 bits (42), Expect = 7.9 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 82 VLFPVVLIMALFGHC 126 +++ ++LIM+L G+C Sbjct: 62 IIYSMLLIMSLVGNC 76 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 483 NNLHYNNLKNIY 518 NN +YNN K +Y Sbjct: 99 NNNNYNNYKKLY 110 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 474 YLGNNLHYNNLKNI 515 Y NN+HY +NI Sbjct: 286 YQANNVHYQGKENI 299 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.0 bits (42), Expect = 7.9 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +1 Query: 82 VLFPVVLIMALFGHC 126 +++ ++LIM+L G+C Sbjct: 62 IIYSMLLIMSLVGNC 76 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 129 LDESVRILLLRDVEVRVAPEP 191 L S+RILL R +++ P P Sbjct: 810 LPNSLRILLKRFLDITTPPTP 830 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,082 Number of Sequences: 438 Number of extensions: 2606 Number of successful extensions: 24 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -