BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0676 (615 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0150 - 20215070-20217577 29 3.9 04_04_0447 - 25297351-25297575,25297663-25298370,25298824-252991... 27 8.9 01_06_1519 + 37942389-37943702,37944142-37944266,37944358-379444... 27 8.9 >02_04_0150 - 20215070-20217577 Length = 835 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -2 Query: 518 PMIAARQAMSPDSTTHSKIFRITTQFQFTKLGSFLLLI 405 PM+ A A+SPD T K F +TT T LG+ L + Sbjct: 34 PMLVATFAVSPDLRTTEK-FMVTTTVLMTFLGAALFAV 70 >04_04_0447 - 25297351-25297575,25297663-25298370,25298824-25299123, 25299876-25299927,25300530-25300673,25301002-25301258, 25301533-25301739,25301819-25301992,25302409-25302432, 25302610-25302677,25304607-25304665,25304802-25304877, 25304965-25305070,25305268-25305377,25305831-25305995, 25306571-25306656,25306893-25306957,25307280-25307330, 25309009-25309056,25309677-25309796,25310226-25310301, 25310780-25310877,25312149-25312404,25313117-25313238 Length = 1198 Score = 27.5 bits (58), Expect = 8.9 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 462 DFTVGSTVWAHCLSCSYHWYDNN 530 +F G +W C S+ W+D N Sbjct: 369 EFGEGGLLWGECSGKSFEWFDGN 391 >01_06_1519 + 37942389-37943702,37944142-37944266,37944358-37944499, 37944602-37944848,37946139-37946196,37947629-37947913, 37947988-37948120 Length = 767 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 412 NRKLPSFVNWNWVVIRKILLWVVLSGLIACLAAIIGMIITIPKECNIDLPWYQ 570 NR S V W + R +W +L A A+++ T+P CN+ + Q Sbjct: 712 NRGWDSSVTWRCRIRR---VWFMLRAAAAAAASVLRQFNTMPDLCNVQRAYEQ 761 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,168,197 Number of Sequences: 37544 Number of extensions: 243841 Number of successful extensions: 518 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -