BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0676 (615 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117204-39|CAB55145.4| 422|Caenorhabditis elegans Hypothetical... 29 2.0 Z79755-9|CAC42297.1| 143|Caenorhabditis elegans Hypothetical pr... 28 6.1 >AL117204-39|CAB55145.4| 422|Caenorhabditis elegans Hypothetical protein Y116A8C.9 protein. Length = 422 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 418 KLPSFVNWNWVVIRKILLWVVLSGLIACLAAIIGMIITI 534 KL V+W W V+ I LWVVLS +A + + +++++ Sbjct: 169 KLDKQVDWTWAVV-FIPLWVVLS--LAAVGVLYALVLSV 204 >Z79755-9|CAC42297.1| 143|Caenorhabditis elegans Hypothetical protein F43G9.13 protein. Length = 143 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 430 FVNWNWVVIRKILLWVVLSGLIACLAAIIGMIITI---PKECNIDLPW 564 ++N W + I LW+ LS ++ L A I + T+ P C I +P+ Sbjct: 38 YMNDWWEITLSIFLWMSLSFMVISLGATILSLFTLRKHPYVCFIPIPF 85 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,559,251 Number of Sequences: 27780 Number of extensions: 230398 Number of successful extensions: 513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -