BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0660 (368 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54654| Best HMM Match : rve (HMM E-Value=0.0035) 26 8.3 SB_12604| Best HMM Match : PsbH (HMM E-Value=5.9) 26 8.3 >SB_54654| Best HMM Match : rve (HMM E-Value=0.0035) Length = 466 Score = 26.2 bits (55), Expect = 8.3 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 303 RYTFDKL--KYTLIKHINSNLYTRNIFQDPYCIIKTFENLFSTMNYF 169 RYT + +YT I H+ T N + Y I+ F +T N+F Sbjct: 392 RYTTTNVFNRYTAINHLFIRYTTTNDLFNRYASIELFNRYTTTNNFF 438 >SB_12604| Best HMM Match : PsbH (HMM E-Value=5.9) Length = 105 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -2 Query: 94 DKHTAHLMASGYRCPWTSAIPGAEPSRCL 8 + +T + + +GY ++S PG EP +CL Sbjct: 13 NNNTEYRLQAGYGLRFSSKRPGYEPGQCL 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,730,598 Number of Sequences: 59808 Number of extensions: 189529 Number of successful extensions: 355 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 594991920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -