BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0660 (368 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64843-11|AAL08038.1| 365|Caenorhabditis elegans Hypothetical p... 27 3.2 U41007-21|AAK84502.1| 465|Caenorhabditis elegans Hypothetical p... 27 4.2 U41007-20|AAA82275.1| 455|Caenorhabditis elegans Hypothetical p... 27 4.2 U13645-6|AAV34802.1| 457|Caenorhabditis elegans Hypothetical pr... 27 4.2 U13645-5|AAM15541.1| 425|Caenorhabditis elegans Hypothetical pr... 27 4.2 U13645-4|AAA20986.2| 529|Caenorhabditis elegans Hypothetical pr... 27 4.2 Z93785-2|CAB07859.2| 1335|Caenorhabditis elegans Hypothetical pr... 26 7.3 >U64843-11|AAL08038.1| 365|Caenorhabditis elegans Hypothetical protein K06C4.17 protein. Length = 365 Score = 27.5 bits (58), Expect = 3.2 Identities = 11/45 (24%), Positives = 29/45 (64%) Frame = +2 Query: 185 LNRFSNVLIIQYGSWNMFLVYKLEFICFIKVYFNLSKVYRYNKNK 319 + +++ + ++QY N+F V+K+ F+ FI + ++ + +Y+ N+ Sbjct: 219 VEKYTFLKVVQYVEENVFSVFKIFFLLFI-INVSIILLLKYSHNE 262 >U41007-21|AAK84502.1| 465|Caenorhabditis elegans Hypothetical protein C33H5.18b protein. Length = 465 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 206 LIIQYGSWNMFLVYKLEFICFIKVYFNLSKVYR 304 ++ + +W MFLV+ ++F CF ++ VYR Sbjct: 112 IVTRGATWLMFLVFLIQFKCFQEIISIGLAVYR 144 >U41007-20|AAA82275.1| 455|Caenorhabditis elegans Hypothetical protein C33H5.18a protein. Length = 455 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 206 LIIQYGSWNMFLVYKLEFICFIKVYFNLSKVYR 304 ++ + +W MFLV+ ++F CF ++ VYR Sbjct: 102 IVTRGATWLMFLVFLIQFKCFQEIISIGLAVYR 134 >U13645-6|AAV34802.1| 457|Caenorhabditis elegans Hypothetical protein C05D10.1c protein. Length = 457 Score = 27.1 bits (57), Expect = 4.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 18 LGSAPGIAEVHGQR*PLAIRWAVCLSTYIG 107 L APG+ E HG L + WA+ L + IG Sbjct: 283 LERAPGLLEEHGGHVKLKLTWAMKLVSRIG 312 >U13645-5|AAM15541.1| 425|Caenorhabditis elegans Hypothetical protein C05D10.1b protein. Length = 425 Score = 27.1 bits (57), Expect = 4.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 18 LGSAPGIAEVHGQR*PLAIRWAVCLSTYIG 107 L APG+ E HG L + WA+ L + IG Sbjct: 251 LERAPGLLEEHGGHVKLKLTWAMKLVSRIG 280 >U13645-4|AAA20986.2| 529|Caenorhabditis elegans Hypothetical protein C05D10.1a protein. Length = 529 Score = 27.1 bits (57), Expect = 4.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 18 LGSAPGIAEVHGQR*PLAIRWAVCLSTYIG 107 L APG+ E HG L + WA+ L + IG Sbjct: 355 LERAPGLLEEHGGHVKLKLTWAMKLVSRIG 384 >Z93785-2|CAB07859.2| 1335|Caenorhabditis elegans Hypothetical protein W09D10.2 protein. Length = 1335 Score = 26.2 bits (55), Expect = 7.3 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +2 Query: 179 MVLNRFSNVLIIQYGS----WNMFLVYKLEFIC 265 +++N F L +QY + W+MFL L FIC Sbjct: 1186 IIVNTFHLALFVQYWTWPMFWSMFLSVLLFFIC 1218 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,202,949 Number of Sequences: 27780 Number of extensions: 159618 Number of successful extensions: 350 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 524900642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -