BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0653 (619 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4FSG8 Cluster: Putative uncharacterized protein; n=1; ... 75 2e-12 UniRef50_O15792 Cluster: CG2; n=89; Plasmodium falciparum|Rep: C... 33 5.5 UniRef50_Q48574 Cluster: ORFC; n=2; Leptospira interrogans|Rep: ... 33 7.2 >UniRef50_A4FSG8 Cluster: Putative uncharacterized protein; n=1; Thermobia domestica|Rep: Putative uncharacterized protein - Thermobia domestica (firebrat) Length = 53 Score = 74.5 bits (175), Expect = 2e-12 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = -2 Query: 363 LIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFKCRSLKF*SVRSLKSYMI 205 +I R +YLRDNSVIFF +S +++ LRPRCWIKI +CRSL + SVR LKSYMI Sbjct: 1 MIVRLSYLRDNSVIFFENSYRQERLRPRCWIKILSRCRSLVYRSVRPLKSYMI 53 >UniRef50_O15792 Cluster: CG2; n=89; Plasmodium falciparum|Rep: CG2 - Plasmodium falciparum Length = 2819 Score = 33.1 bits (72), Expect = 5.5 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 4/80 (5%) Frame = -2 Query: 438 VGVIKKFN*LFLIVYINK*LNDPILLIKRKNYLRD----NSVIFFFSSNKKKSLRPRCWI 271 + I + ++ IN L + +KR YL + N+ I FF + + K L R I Sbjct: 2088 INTINENGNMYTYSLINSTLTLNNIHMKRWKYLINTYCFNNYIMFFQTTQNKYLLNRRLI 2147 Query: 270 KIKFKCRSLKF*SVRSLKSY 211 K F RSLKF +KSY Sbjct: 2148 KKAFFLRSLKFDDFNDIKSY 2167 >UniRef50_Q48574 Cluster: ORFC; n=2; Leptospira interrogans|Rep: ORFC - Leptospira interrogans serovar Icterohaemorrhagiae Length = 85 Score = 32.7 bits (71), Expect = 7.2 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = -2 Query: 405 LIVYINK*LNDPILLIKRKNYLRDNSVIFFFSSNKKKSLRPRC 277 + VY NK L D ++++ + + N + F FS N++++ + RC Sbjct: 5 ICVYYNKLLYDQKVILRLLEFYKSNYIPFLFSENQRRTRQLRC 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,085,996 Number of Sequences: 1657284 Number of extensions: 6283873 Number of successful extensions: 9575 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9569 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44807090004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -