BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0653 (619 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110484-27|CAI46626.1| 397|Caenorhabditis elegans Hypothetical... 30 1.5 AC006608-11|AAF39761.1| 360|Caenorhabditis elegans Hypothetical... 27 8.1 >AL110484-27|CAI46626.1| 397|Caenorhabditis elegans Hypothetical protein Y38E10A.28 protein. Length = 397 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 133 LNITII-LSCVEFY*VLFKSSNYFNLFIKKKKKNSR 29 +N+ I+ L+CV Y +LF SS +L+ + K NSR Sbjct: 1 MNVAILALNCVSLYFLLFLSSFAIDLYTLETKNNSR 36 >AC006608-11|AAF39761.1| 360|Caenorhabditis elegans Hypothetical protein C15F1.1 protein. Length = 360 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -1 Query: 133 LNITIILSCVEFY*VLFKSSNYFNLFIKKKKKNSRLVLSL 14 LNI +++ + + L +SN FNL KKKK+ R S+ Sbjct: 37 LNIQLLIVHLTIFTGLHPNSNKFNLKWKKKKETQRKQCSI 76 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,995,039 Number of Sequences: 27780 Number of extensions: 158270 Number of successful extensions: 210 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 210 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -